Bacterial taxon 909946
Locus STM474_4683
Protein WP_000896756.1
gluconokinase
Salmonella enterica Serovar Typhimurium ST4 74
Length 176 aa, Gene idnK, UniProt E8XBN8
>WP_000896756.1|Salmonella enterica Serovar Typhimurium ST4 74|gluconokinase
MAGESYILMGVSGSGKSLIGSKIATLFSAKFIDGDDLHPAKNIDKMSQGIPLTDEDRLPWLERLNDASYSLYKKNETGFIVCSSLKKQYRDILRKSSPNVHFLWLDGDYATILQRMQRRAGHFMPPDLLQSQFDALERPCADEHDIARIDVNHDIEHVTEQCRLAVQAFRQALSAS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,750,172 | -0.69 | 0.16 | ●○○○○ -0.18 | -0.181180576525956 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,750,172 | -0.41 | 0.75 | ●○○○○ -0.03 | -0.0336465324551902 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,750,172 | 0.34 | 0.98 | ○○○○○ 0.36 | 0.355006553986481 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)