Bacterial taxon 909946
Locus STM474_1971
Protein WP_000240837.1
glucose-6-phosphate dehydrogenase
Salmonella enterica Serovar Typhimurium ST4 74
Length 108 aa, Gene n/a, UniProt E8XA85
>WP_000240837.1|Salmonella enterica Serovar Typhimurium ST4 74|glucose-6-phosphate dehydrogenase
MVKRRNLLHFNNGARSERDLGDLVTKVFEKAAKKEPQPLYTFSLPLLSVQDEIRVYCKKKNIKIGYDTLFMEITFSADREAVDELIKHFFTENKLYLRGRFYLSAAVV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,990,194 | -3.52 | 3.0e-11 | ●●○○○ -1.65 | -1.64996105495199 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,990,194 | -1.76 | 0.022 | ●○○○○ -0.74 | -0.739296458245673 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,990,194 | -2.96 | 0.063 | ●●○○○ -1.36 | -1.35855239174463 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)