Bacterial taxon 909946
Locus STM474_0853
Protein WP_000569093.1
glutamine ABC transporter ATP-binding protein GlnQ
Salmonella enterica Serovar Typhimurium ST4 74
Length 240 aa, Gene glnQ, UniProt E8XBU0
>WP_000569093.1|Salmonella enterica Serovar Typhimurium ST4 74|glutamine ABC transporter ATP-binding protein GlnQ
MIEFKNVSKHFGPTQVLHNIDLNIRQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPKVDERLIRQEAGMVFQQFYLFPHLTALENVMFGPLRVRGVKKEEAEKQAKALLAKVGLAERAHHYPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEIGFAEKVASRLIFIDKGRIAEDGSPQALIENPPSPRLQEFLQHVS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 894,229 | 0.16 | 1 | ○○○○○ 0.26 | 0.261547670228049 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 894,229 | 1.03 | 0.073 | ○○○○○ 0.71 | 0.714012783442836 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 894,229 | 1.11 | 0.51 | ○○○○○ 0.75 | 0.75437340019956 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)