Bacterial taxon 909946
Locus STM474_0898
Protein WP_000495513.1
glutaredoxin, GrxA family
Salmonella enterica Serovar Typhimurium ST4 74
Length 87 aa, Gene grxA, UniProt E8XCM0
>WP_000495513.1|Salmonella enterica Serovar Typhimurium ST4 74|glutaredoxin, GrxA family
MFTVIFGRPGCPYCVRAKELAEKLSKERDDFNYRYIDIHAEGITKADLEKTVGKPVETVPQIFVDQKHIGGCTDFEAWAKENLNLFA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 944,492 | 1.79 | 0.033 | ○○○○○ 1.11 | 1.10693701848006 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 944,492 | 0.33 | 0.98 | ○○○○○ 0.35 | 0.346107023313712 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 944,492 | 1.84 | 0.21 | ○○○○○ 1.13 | 1.13131720262422 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)