Bacterial taxon 909946
Locus STM474_2445
Protein WP_000043010.1
glutathione transferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 214 aa, Gene yfcF, UniProt E8XF01
>WP_000043010.1|Salmonella enterica Serovar Typhimurium ST4 74|glutathione transferase
MSKPVIVLWSDANFFSPYVLSAWVALQEKGLSFTLKTRDLDQGEHLQPGWRGYALTQRVPVLEADNFELSESSAIAEYLEERFAPPQWERIYPHDLQKRARARQIQAWLRSDLLPLREERPTDVVFAGAKKAPLSEAGKASAAKLFATAEALLGQGTQNLFGEWCIADTDLALMINRLALHGDDVPASLAAYATFQWQRASVQRFIALSSKRSG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,457,723 | 1.68 | 0.023 | ○○○○○ 1.05 | 1.04770199018895 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,457,723 | -0.43 | 0.89 | ●○○○○ -0.05 | -0.0472416403757361 | 23637626 |
Retrieved 2 of 2 entries in 1.9 ms
(Link to these results)