Bacterial taxon 909946
Locus STM474_3624
Protein WP_000081820.1
glutathione-regulated potassium-efflux system ancillary protein KefG
Salmonella enterica Serovar Typhimurium ST4 74
Length 183 aa, Gene kefG, UniProt E8XE03
>WP_000081820.1|Salmonella enterica Serovar Typhimurium ST4 74|glutathione-regulated potassium-efflux system ancillary protein KefG
MSQPAKVLLLYAHPESQDSVANRVLLKPAIQHNNVTVHDLYARYPDFFIDTPYEQALLREHDVIVFQHPLYTYSCPALLKEWLDRVLSRGFASGPGGNQLVGKYWRSVITTGEPESAYRYDALNRYPMSDVLRPFELTAAMCRMHWMPPIIVYWARRQSPQTLASHAKAYGEWLANPVSAGGY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,630,931 | 1.28 | 0.12 | ○○○○○ 0.84 | 0.841846925240706 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,630,931 | 1.44 | 0.48 | ○○○○○ 0.92 | 0.922697798923513 | 23637626 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)