Bacterial taxon 909946
Locus STM474_0089
Protein WP_000600709.1
glutathione-regulated potassium-efflux system oxidoreductase KefF
Salmonella enterica Serovar Typhimurium ST4 74
Length 176 aa, Gene yabF, UniProt E8XGZ4
>WP_000600709.1|Salmonella enterica Serovar Typhimurium ST4 74|glutathione-regulated potassium-efflux system oxidoreductase KefF
MILIIYAHPYPHHSHANKRMLEQAGTLENVEIRSLYHLYPDFNIDVAAEQEALSRASLIVWQHPMQWYSVPPLLKLWMDKVLTHGWAYGHGGTALHGKHLLWAVTTGGGENHFAIGSHPGFDVLSQPLQATALYCGLKWLSPFAMHCTFICDDDTLQAQARQYKQRLLAWQEVNHG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 98,373 | 0.36 | 0.79 | ○○○○○ 0.37 | 0.365568394467624 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 98,373 | 0.48 | 0.92 | ○○○○○ 0.42 | 0.423792984313614 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 98,373 | 1.55 | 0.065 | ○○○○○ 0.98 | 0.979723837394539 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)