Bacterial taxon 909946
Locus STM474_1209
Protein WP_001043449.1
glycine zipper 2TM domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 179 aa, Gene ycfj, UniProt E8XEY0
>WP_001043449.1|Salmonella enterica Serovar Typhimurium ST4 74|glycine zipper 2TM domain-containing protein
MNKSMLAGIGIGVAAALGVAAVASLNVFDRGPQYAQVISAKPIKETVKTPRQECRNVTVTHRRPVQDENRIAGSVLGAVAGGVIGHQFGGGRGKDVATVVGALGGGYAGNQIQGSMQESDTYTTTQQRCKTVYDKSEKMLGYDVTYKIGDQQGKIRMDKDPGTQIPLDGNGQLVLNNKA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,252,106 | 1.42 | 0.05 | ○○○○○ 0.92 | 0.915909557314842 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,252,106 | 0.26 | 0.97 | ○○○○○ 0.31 | 0.309922062522756 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,252,106 | 0.28 | 0.83 | ○○○○○ 0.32 | 0.324157103280401 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)