Bacterial taxon 909946
Locus STM474_3823
Protein WP_000533909.1
GNAT family N-acetyltransferase
Salmonella enterica Serovar Typhimurium ST4 74
Length 161 aa, Gene n/a, UniProt E8XFW6
>WP_000533909.1|Salmonella enterica Serovar Typhimurium ST4 74|GNAT family N-acetyltransferase
MGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNMPDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLPQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,859,330 | 0.3 | 0.86 | ○○○○○ 0.33 | 0.333402108591571 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,859,330 | 0.33 | 1 | ○○○○○ 0.35 | 0.347156671059004 | 23637626 |
Retrieved 2 of 2 entries in 1.7 ms
(Link to these results)