Bacterial taxon 909946
Locus STM474_3518
Protein WP_000723776.1
GntR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 209 aa, Gene n/a, UniProt E8XD61
>WP_000723776.1|Salmonella enterica Serovar Typhimurium ST4 74|GntR family transcriptional regulator
MKKIQRTQTRDHITQMLRYEILSGNIKAGEELAQESIAEQLGLSRMPVREALQSLEQEGFLIRLPNRHMQVAHLEADRVSHIFRVIAAMAAEMFSLIPSEVGDALLIRAQALAVAEDKSCELECHAMLISYVNNRYLEKVYQQFLDGYVSYVILHLKKDNQESAQLFAELADVIRQGRRDEIGQVMQRYFLSLAEIMRQHMKDWESAEA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,547,464 | -3.31 | 0.0022 | ●●○○○ -1.54 | -1.53955404493067 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,547,464 | -0.54 | 0.69 | ●○○○○ -0.1 | -0.102959154270291 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,547,464 | -0.12 | 0.88 | ○○○○○ 0.11 | 0.112849171948364 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)