Bacterial taxon 909946
Locus STM474_3959
Protein WP_000854956.1
GntR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 247 aa, Gene n/a, UniProt E8XGY2
>WP_000854956.1|Salmonella enterica Serovar Typhimurium ST4 74|GntR family transcriptional regulator
MKTLSKSSHIPLYQQVVEWIRESIYSGELVEDDRIPSEFQIMDMLEVSRGTVKKAVDQLVREGVLVQVQGKGTFVKKENVAYPLGEGLLSFAEALASQKINFTTSVITSRLEPANRFVAEKLSIKPGQDVLFLKRLRCIGDEKVMLIENRINIDLCPGIIDVDFTRENLFSAIERLSDKKISFSESRYAAKLIGNERGHYLDIGEDAPVLHLEQLVFFSRGLAIDFGNVWLKGNKYYLGTILQRLDA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,006,159 | -0.49 | 0.89 | ●○○○○ -0.08 | -0.0775154717378835 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,006,362 | -0.16 | 0.92 | ○○○○○ 0.09 | 0.0939585972625568 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,006,362 | 0.06 | 1 | ○○○○○ 0.21 | 0.209927563514833 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,006,159 | 0.66 | 0.3 | ○○○○○ 0.52 | 0.520381036322607 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,006,362 | 0.73 | 0.35 | ○○○○○ 0.56 | 0.557967951601744 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,006,159 | 0.89 | 0.6 | ○○○○○ 0.64 | 0.641151604674333 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)