Bacterial taxon 909946
Locus STM474_4250
Protein WP_001519915.1
GntR family transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 240 aa, Gene n/a, UniProt E8XKD5
>WP_001519915.1|Salmonella enterica Serovar Typhimurium ST4 74|GntR family transcriptional regulator
MQVDKTSFTPLYKQLFFIICQQIQNGSLPLGSQLPTQKEIARSYNVSLIVVKQAWSELINAGIISSQRGSGSVVCSVPEGVSYGHTFRGITRDLQDASVAIENRILEIAPRRARDAQADGLSLPAQHHYLYISRIRCLNNRPFNHEKIYLDLSFFPGLELTPQALEHTSLYSLLNVTSDSAIEKVEAILPSADLCEKLQIAANKPLLSVARQTFQAGKDSPFEYCRYYVLSEYFGEIHYH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,301,035 | -4.29 | 6.6e-5 | ●●●○○ -2.05 | -2.04950216449058 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,301,035 | -4.04 | 6.6e-13 | ●●○○○ -1.92 | -1.91910785771652 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,301,035 | -3.61 | 0.0028 | ●●○○○ -1.7 | -1.69966434973287 | 23637626 |
Retrieved 3 of 3 entries in 0.6 ms
(Link to these results)