Bacterial taxon 909946
Locus STM474_0578
Protein WP_000915523.1
GtrA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 120 aa, Gene n/a, UniProt E8X931
>WP_000915523.1|Salmonella enterica Serovar Typhimurium ST4 74|GtrA family protein
MLKLFAKYTSIGVLNTLIHWGVFAFCVYGMHTHQALANFSGFVIAVSFSFYANARFTFNASTTTLRYMMYVGFMGTLSAVVGWMADKCSLPPLLTLVTFSAISLICGFIYSKFIVFRDAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 616,865 | -1.7 | 0.093 | ●○○○○ -0.71 | -0.705324758638394 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 616,900 | -0.64 | 0.4 | ●○○○○ -0.15 | -0.15318406329918 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 616,865 | 0 | 1 | ○○○○○ 0.18 | 0.177993874548431 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 616,900 | 0.62 | 0.88 | ○○○○○ 0.5 | 0.498533249396439 | 23637626 |
Retrieved 4 of 4 entries in 1.7 ms
(Link to these results)