Bacterial taxon 909946
Locus STM474_4398
Protein WP_000593182.1
GtrA family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 120 aa, Gene gtrA, UniProt E8X8W6
>WP_000593182.1|Salmonella enterica Serovar Typhimurium ST4 74|GtrA family protein
MIKLFIKYVSIGVLNTALHWAIFALCVYGFQTSQALANVAGFAVAVSFSFFANARFTFGASVSTGRYLLYVGFMGVLSAVVGWTGDKCAMPPIFTLIVFSAISLICGFLYSRFIVFRNEK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,448,325 | -4.48 | 4.0e-10 | ●●●○○ -2.15 | -2.14980273772891 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,448,384 | -2.82 | 4.4e-5 | ●●○○○ -1.29 | -1.28981372175389 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,448,384 | -2.71 | 1.0e-7 | ●●○○○ -1.23 | -1.23088410400898 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,448,330 | -2.52 | 0.0049 | ●●○○○ -1.13 | -1.1328426329035 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,448,325 | -1.77 | 0.15 | ●○○○○ -0.74 | -0.743006644636021 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,448,384 | -1.03 | 0.59 | ●○○○○ -0.36 | -0.35644138358066 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,448,325 | -0.33 | 0.95 | ○○○○○ 0.01 | 0.0082716514462855 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,448,330 | 0.1 | 0.9 | ○○○○○ 0.23 | 0.230348111557616 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,448,308 | 0.15 | 0.91 | ○○○○○ 0.26 | 0.257131176866615 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,448,308 | 0.35 | 0.95 | ○○○○○ 0.36 | 0.358588386030722 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,448,330 | 1.08 | 0.94 | ○○○○○ 0.74 | 0.735999722826134 | 23637626 |
Retrieved 11 of 11 entries in 0.8 ms
(Link to these results)