Bacterial taxon 909946
Locus STM474_3280
Protein WP_000338754.1
Hcp1 family type VI secretion system effector
Salmonella enterica Serovar Typhimurium ST4 74
Length 161 aa, Gene n/a, UniProt E8XAI0
>WP_000338754.1|Salmonella enterica Serovar Typhimurium ST4 74|Hcp1 family type VI secretion system effector
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTKFVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKPVETMSLNFTKIEWQITAEKSDGAQQESRTSVWDLAMNQIGK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,311,997 | -5.4 | 1.0e-20 | ●●●○○ -2.63 | -2.62507347129155 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,311,997 | -3.43 | 0.0011 | ●●○○○ -1.6 | -1.60194406647417 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,311,997 | -1.29 | 0.46 | ●○○○○ -0.49 | -0.494790842011635 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)