Bacterial taxon 909946
Locus STM474_2069
Protein WP_000061500.1
helix-turn-helix domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 272 aa, Gene n/a, UniProt E8XB56
>WP_000061500.1|Salmonella enterica Serovar Typhimurium ST4 74|helix-turn-helix domain-containing protein
MSMELMVKAMKIRVGNPLRKLVLIKLADNASDQGECWPSYQHIADQCEISKRSVMNHIAALCESGLVKKVTRKGEKGNSSNIYLLHLDGAGDSLGGSANNSLPGAANSLGSAGVAPGGSEGDSPRTSHSFEPVKEPVNESKTIGASAYASSSVCFARQEYSPEFEQAWLAYPKRAGGNSKSAAYKAWKARLKEGVNAETMLEGVKRYAGWVSATGNSGTQFVKQATTFFGPDRHFGELWAVPAAPSPGREDPMFKSSYGNVDYSQIPTGFRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,069,526 | -1.5 | 0.0047 | ●○○○○ -0.6 | -0.602422610267902 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,069,254 | 2.05 | 0.0085 | ○○○○○ 1.24 | 1.2401428998351 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,069,579 | -1.43 | 0.17 | ●○○○○ -0.57 | -0.565630583029998 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,069,526 | -0.32 | 0.92 | ○○○○○ 0.01 | 0.00991602360483257 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,069,254 | 0.25 | 0.86 | ○○○○○ 0.31 | 0.305889570201033 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,069,526 | 0.27 | 0.73 | ○○○○○ 0.32 | 0.318847142960553 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,069,579 | 0.62 | 0.87 | ○○○○○ 0.5 | 0.499976500829975 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,069,254 | 0.8 | 0.81 | ○○○○○ 0.59 | 0.590895638547785 | 23637626 |
Retrieved 8 of 8 entries in 1 ms
(Link to these results)