Bacterial taxon 909946
Locus STM474_3328
Protein WP_000998789.1
helix-turn-helix domain-containing protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 288 aa, Gene n/a, UniProt E8XBA3
>WP_000998789.1|Salmonella enterica Serovar Typhimurium ST4 74|helix-turn-helix domain-containing protein
MNDLISAAYSERLRRVCDHIERHLDEPLSIEALSRMAHSSPFHFHRQFTTWSGLPLYRYIQWLRLRRASWRLAFNPQDKVIDIALDAGFQNPESFTRAFKTAFGQSPRRFRQSPDWLAWHQRVPKLALQEQHVMDVKIVEFPPTRVAMLTHLGHPDKVNASAAKFIAWRRETGQSPIASSQTFGIAWHDPQTTPPAQFRFDICGSVRQPIAENDVGVVNSEIPGGRCAVVRHQGSLDSLPESVWYLFREWLPASGETPRDFPVFFQYLNFVHEVAEHELLTDIYLPLR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,360,547 | -0.23 | 0.87 | ○○○○○ 0.06 | 0.0567336630402721 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,360,328 | -0.12 | 0.97 | ○○○○○ 0.12 | 0.115258409525411 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,360,547 | -0.1 | 0.98 | ○○○○○ 0.13 | 0.126065093915304 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,360,547 | 0.39 | 0.57 | ○○○○○ 0.38 | 0.381004223288744 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,360,128 | 0.59 | 0.89 | ○○○○○ 0.48 | 0.484901097198799 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,360,128 | 1.03 | 0.16 | ○○○○○ 0.71 | 0.712135732322912 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,360,328 | 1.08 | 0.051 | ○○○○○ 0.74 | 0.736910626814983 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,360,328 | 1.2 | 0.41 | ○○○○○ 0.8 | 0.801811153864349 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,360,128 | 1.91 | 0.18 | ○○○○○ 1.17 | 1.16753248308593 | 23637626 |
Retrieved 9 of 9 entries in 2 ms
(Link to these results)