Bacterial taxon 909946
Locus STM474_3196
Protein WP_000250289.1
hemolysin III family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 219 aa, Gene yqfA, UniProt E8X9M0
>WP_000250289.1|Salmonella enterica Serovar Typhimurium ST4 74|hemolysin III family protein
MVQKPLMTQGYSLAEEIANSISHGIGLVFGIVGLVLLLVQAVEANAGMTAIASYSLYGGSMILLFLASTLYHAIPHQRAKIWLKKFDHCAIYLLIAGTYTPFLLVGLDSPLARGLMIVIWSLALFGILFKLTIAHRFKVLSLVTYLAMGWLSLIVVYQLAIKLAIGGVTLLAVGGVVYSLGVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYVGQA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,229,320 | 0.93 | 0.27 | ○○○○○ 0.66 | 0.66029312106236 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,229,320 | 1.17 | 0.48 | ○○○○○ 0.79 | 0.785154333559794 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,229,320 | 1.29 | 0.58 | ○○○○○ 0.84 | 0.84490480923658 | 23637626 |
Retrieved 3 of 3 entries in 0.5 ms
(Link to these results)