Bacterial taxon 909946
Locus STM474_0494
Protein WP_000344807.1
Hha toxicity modulator TomB
Salmonella enterica Serovar Typhimurium ST4 74
Length 124 aa, Gene ybaj, UniProt E8X860
>WP_000344807.1|Salmonella enterica Serovar Typhimurium ST4 74|Hha toxicity modulator TomB
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYLDDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 527,889 | -3.66 | 0.00074 | ●●○○○ -1.72 | -1.72254469219887 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 528,179 | 2.3 | 0.012 | ○○○○○ 1.37 | 1.3692715784674 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 528,174 | 2.93 | 0.00083 | ○○○○○ 1.7 | 1.69935469701721 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 528,179 | -0.22 | 0.89 | ○○○○○ 0.07 | 0.0652523765918924 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 528,122 | 0.42 | 0.94 | ○○○○○ 0.4 | 0.396193778527683 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 527,989 | 0.45 | 0.93 | ○○○○○ 0.41 | 0.410280853538045 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 527,889 | 0.61 | 0.69 | ○○○○○ 0.49 | 0.491384005639168 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 528,179 | 0.94 | 0.75 | ○○○○○ 0.66 | 0.664301037853474 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 528,122 | 0.99 | 0.83 | ○○○○○ 0.69 | 0.690613445632976 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 527,889 | 1.01 | 0.2 | ○○○○○ 0.7 | 0.701829259144054 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 527,989 | 1.24 | 0.097 | ○○○○○ 0.82 | 0.82164864545706 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 528,174 | 1.48 | 0.39 | ○○○○○ 0.94 | 0.944674959610588 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 527,989 | 1.51 | 0.41 | ○○○○○ 0.96 | 0.960872240394537 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 528,174 | 2 | 0.8 | ○○○○○ 1.22 | 1.21791048142115 | 23637626 |
Retrieved 14 of 14 entries in 1.2 ms
(Link to these results)