Bacterial taxon 909946
Locus STM474_2451
Protein WP_000731868.1
histidine ABC transporter substrate-binding protein HisJ
Salmonella enterica Serovar Typhimurium ST4 74
Length 260 aa, Gene hisJ, UniProt E8XF07
>WP_000731868.1|Salmonella enterica Serovar Typhimurium ST4 74|histidine ABC transporter substrate-binding protein HisJ
MKKLALSLSLVLAFSSATAAFAAIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 2,462,612 | 0.02 | 0.97 | ○○○○○ 0.19 | 0.189749204643939 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 2,462,612 | 0.72 | 0.64 | ○○○○○ 0.55 | 0.549700189619324 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 2,462,612 | 1.27 | 0.59 | ○○○○○ 0.84 | 0.8354230919659 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)