Bacterial taxon 909946
Locus STM474_0814
Protein WP_000287416.1
histidine utilization repressor
Salmonella enterica Serovar Typhimurium ST4 74
Length 241 aa, Gene hutC, UniProt E8XBQ2
>WP_000287416.1|Salmonella enterica Serovar Typhimurium ST4 74|histidine utilization repressor
MYSSRSRSAPAPFYETVKQDICKKIAGGVWQPHDRIPSEAELVAQYGFSRMTINRALRELTDEGWLVRLQGVGTFVAEPKGQSALFEVRSIAEEIAARRHQHRCEVLTLERVRANAIQASALNVNESDVIFHSIMVHYENDLPVQIEDRCVNADIAVDYLTQDYSQTTPHAYLSRIAPLTEGEHIVEAVRATAQECAWLTIKEHEPCLLIRRTTWSASRIVSHARLLFPGSRYRLQGRFIS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 853,440 | -0.55 | 0.84 | ●○○○○ -0.11 | -0.111089596457237 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 853,440 | 0.56 | 0.71 | ○○○○○ 0.47 | 0.466284127629014 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 853,440 | 0.84 | 0.79 | ○○○○○ 0.61 | 0.614783983872858 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 853,440 | 0.85 | 0.46 | ○○○○○ 0.62 | 0.618091347180695 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 853,440 | 1.06 | 0.16 | ○○○○○ 0.73 | 0.726321119322689 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 853,440 | 1.08 | 0.16 | ○○○○○ 0.74 | 0.737480963170244 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)