Bacterial taxon 909946
Locus STM474_3953
Protein WP_000621026.1
HPr family phosphocarrier protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 89 aa, Gene n/a, UniProt E8XGX6
>WP_000621026.1|Salmonella enterica Serovar Typhimurium ST4 74|HPr family phosphocarrier protein
MIRQKVRVMNSTGLHARPAATLAKIVKKYQSSLTLVNNDKEIPIKGMMSILGAGVKGNTMIDLICDGQDELAFMDELKSAFADGFGESV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,000,880 | -0.42 | 0.52 | ●○○○○ -0.04 | -0.0407053604034007 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,000,880 | -0.41 | 0.89 | ●○○○○ -0.04 | -0.0360141438413479 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,000,880 | 0.26 | 0.89 | ○○○○○ 0.31 | 0.312119470585901 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,000,871 | 0.51 | 0.95 | ○○○○○ 0.44 | 0.440750764637193 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,000,871 | 0.6 | 0.33 | ○○○○○ 0.49 | 0.486881773936378 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,000,871 | 1.34 | 0.56 | ○○○○○ 0.87 | 0.874696082453052 | 23637626 |
Retrieved 6 of 6 entries in 1.5 ms
(Link to these results)