Bacterial taxon 909946
Locus STM474_1251
Protein WP_001518864.1
Hsp20 family protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 156 aa, Gene n/a, UniProt E8XFH8
>WP_001518864.1|Salmonella enterica Serovar Typhimurium ST4 74|Hsp20 family protein
MMALRTLSALPVFADSLFSDRFNRIDRLFSQLTGDTPVAATPAYDLQKRDANNYLLTVSVPGWKEEELEIETVGGNLNITGKHTEETVEDQTHWIYRGIRKADFQLSFSLPEHAKVNNAKLEQGLLLVEIYQEIPESEKPKKIAIESKPKAIEHKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,292,694 | -1.41 | 0.0065 | ●○○○○ -0.56 | -0.556831719958224 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,292,694 | -1.62 | 0.11 | ●○○○○ -0.66 | -0.664161700407799 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,292,694 | 0.29 | 0.97 | ○○○○○ 0.33 | 0.329785235786434 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)