Bacterial taxon 909946
Locus STM474_4228
Protein WP_000217112.1
HTH-type transcriptional activator RhaS
Salmonella enterica Serovar Typhimurium ST4 74
Length 278 aa, Gene rhaS, UniProt E8XKB3
>WP_000217112.1|Salmonella enterica Serovar Typhimurium ST4 74|HTH-type transcriptional activator RhaS
MTVLHSVDFFPSGKAPVAIEPRLPQAAFPEHHHDFHEIVIVEHGTGIHVFNGQPYTISGGTVCFVRDHDRHLYEHTDNLCLTNVLWRSPDAFQFLAGLDQLLPQEQDGYYPSHWRVNQSVLQQVRQLVGLMERAGDGMDAPAVANREILFMQLLVLLRRSSLMEGATNNDAKLNQLMAWLEDHFAEEVCWEAVAEQFSLSLRTLHRQLKQHTGLTPQRYLNRLRLIKARHLLRHSDHSVTEIAYRCGFGDSNHFSTLFRREFNWSPRDIRQGRDAIIQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,280,636 | -0.92 | 0.21 | ●○○○○ -0.3 | -0.298345958211743 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,280,636 | -0.54 | 0.72 | ●○○○○ -0.1 | -0.10483261432891 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 4,280,757 | -0.01 | 1 | ○○○○○ 0.17 | 0.172839682160255 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,280,636 | 0.2 | 0.99 | ○○○○○ 0.28 | 0.27865197000741 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 4,280,757 | 0.94 | 0.85 | ○○○○○ 0.67 | 0.666392443914795 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 4,280,757 | 1.43 | 0.066 | ○○○○○ 0.92 | 0.921533114658171 | 23637626 |
Retrieved 6 of 6 entries in 1.6 ms
(Link to these results)