Bacterial taxon 909946
Locus STM474_3820
Protein WP_000455790.1
HTH-type transcriptional regulator
Salmonella enterica Serovar Typhimurium ST4 74
Length 96 aa, Gene yiaG, UniProt E8XFW3
>WP_000455790.1|Salmonella enterica Serovar Typhimurium ST4 74|HTH-type transcriptional regulator
MEYKDPMFELLSSLEQIVFKDETRKITLTQKPNPFTEFEQLRRGTGLKTDEFARALGVTVAMVQEWESKREKPTPAELKLMRLIQANPRLSKQLME
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,857,400 | 1.4 | 0.015 | ○○○○○ 0.9 | 0.904502261560001 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,857,400 | 0.43 | 0.93 | ○○○○○ 0.4 | 0.402662272349301 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,857,400 | 0.6 | 0.72 | ○○○○○ 0.49 | 0.490483859254794 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)