Bacterial taxon 909946
Locus STM474_1116
Protein WP_000083126.1
HTH-type transcriptional regulator RutR
Salmonella enterica Serovar Typhimurium ST4 74
Length 212 aa, Gene ycdC, UniProt E8XE80
>WP_000083126.1|Salmonella enterica Serovar Typhimurium ST4 74|HTH-type transcriptional regulator RutR
MSQRTEKKIGKRSQATGAKRQLILTAALAVFSQYGIHGARLEQVAERAGVSKTNLLYYYPSKEALYVAVMRQILDVWLAPLKAFRAEFSPLEAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMEELTGDLKALIDEKSALIAGWVHSGKLAPISPHHLIFMIWAATQHYADFAPQVEAVTGATLRDEAFFNQTVESVQRIIIEGIRVR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,163,340 | 1.46 | 0.041 | ○○○○○ 0.93 | 0.934930389115899 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,163,340 | 0.73 | 0.84 | ○○○○○ 0.56 | 0.557662221676994 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,163,340 | 1.69 | 0.24 | ○○○○○ 1.05 | 1.05474059082872 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)