Bacterial taxon 909946
Locus STM474_0389
Protein WP_000950242.1
hydrogen peroxide resistance inhibitor IprA
Salmonella enterica Serovar Typhimurium ST4 74
Length 207 aa, Gene yaiv, UniProt E8XJS3
>WP_000950242.1|Salmonella enterica Serovar Typhimurium ST4 74|hydrogen peroxide resistance inhibitor IprA
MLSLSKPLQEFYRLDKCLSKHGTRFEFVNDKEIICSPDESNTHTFVILEGVVSLVRGDKVLIGIVQAPFIFGLADGVAKKEAQYKLIAESGCIGYRLSSSQTLAIIEQNQLWREAFCWIVWKSQVLELRDKQLIGNNSYDQIRATLMTMIEWDEELRSRIGVMNYIHQRTRVSRSVVAEVLAALRKGNYIEMNKGKLISINRLPSEY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 427,773 | -5.02 | 3.3e-13 | ●●●○○ -2.43 | -2.42870973145567 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 427,773 | -2.66 | 0.016 | ●●○○○ -1.21 | -1.20554385858298 | 23637626 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)