Bacterial taxon 909946
Locus STM474_0633
Protein WP_000417097.1
hydrogenase
Salmonella enterica Serovar Typhimurium ST4 74
Length 255 aa, Gene ynfH, UniProt E8X984
>WP_000417097.1|Salmonella enterica Serovar Typhimurium ST4 74|hydrogenase
MEKYELPLVFFTVLSQMSVGMALVLTWRTLRGEVEGQRFYWLATGLVLALASIAAILHLAHPDRAYDALINLRHAWLSREILGATLFGAAVGVTFLAKGHKAMALIASVFGVLLVAVQGMTYAAPAMVAIANGFTMLLFFITVWVMGCAAIPLLKLRPAVPALRQGIVVCIAVLIAAPLVWLSGGTVMQMTARSWLASPFYLASLVCLALAFVASRHGDSRPKRLFVLLFVGVFLSRLVFFGDTVSTIVNIGHLY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 676,383 | -1.5 | 0.0029 | ●○○○○ -0.6 | -0.604025002582233 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 676,109 | 0.01 | 1 | ○○○○○ 0.18 | 0.183919164131776 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 676,109 | 0.45 | 0.25 | ○○○○○ 0.41 | 0.411539501051316 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 676,109 | 0.5 | 0.79 | ○○○○○ 0.44 | 0.435815104038726 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 676,383 | 1.03 | 0.71 | ○○○○○ 0.71 | 0.714113788598401 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 676,383 | 1.38 | 0.32 | ○○○○○ 0.9 | 0.895545817628859 | 23637626 |
Retrieved 6 of 6 entries in 1 ms
(Link to these results)