Bacterial taxon 909946
Locus STM474_3300
Protein WP_000145429.1
hydrogenase 2 small subunit
Salmonella enterica Serovar Typhimurium ST4 74
Length 372 aa, Gene hypO, UniProt E8XAK0
>WP_000145429.1|Salmonella enterica Serovar Typhimurium ST4 74|hydrogenase 2 small subunit
MTGDNTLITSHGINRRDFMKLCAALAATMGLSSKAAAEMAESVSNPQRPPVIWIGAQECTGCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGSIPLKDNGIYCMVAGEPIVDHIRKAADGAAAIIAIGSCSAWGGVAAAGVNPTGAVSLQEVLPGKTVINIPGCPPNPHNFLATVAHIITYGTPPKLDAKNRPTFAYGRLIHEHCERRPHFDAGRFAKEFGDEGHRQGWCLYHLGCKGPETWGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGIGFHKGIHQLAHVENQTPRSEKPDVNMKEGGNISAGAVGLLGGVVGLVAGVSVMAVRELGRQQKKDNADSRGE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,333,901 | -9.8 | 7.2e-11 | ●●●●● -4.91 | -4.91421329687123 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,334,398 | -6.75 | 1.3e-45 | ●●●●○ -3.33 | -3.32781082305795 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,334,398 | -5.79 | 6.3e-7 | ●●●○○ -2.83 | -2.83226636055291 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,333,456 | -5.23 | 2.3e-17 | ●●●○○ -2.54 | -2.53978116467708 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,334,398 | -4.47 | 0.00039 | ●●●○○ -2.14 | -2.14235045150058 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,333,752 | -2.95 | 0.0054 | ●●○○○ -1.36 | -1.35733042706541 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,333,456 | -2.77 | 0.012 | ●●○○○ -1.26 | -1.26174489550996 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,334,086 | 1.83 | 0.016 | ○○○○○ 1.13 | 1.1285050448528 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,333,901 | 2.51 | 0.0017 | ○○○○○ 1.48 | 1.47826897566632 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,334,086 | -1.84 | 0.34 | ●○○○○ -0.78 | -0.776361373945282 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,334,086 | -0.68 | 0.92 | ●○○○○ -0.18 | -0.178270316568277 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,333,901 | -0.41 | 0.76 | ●○○○○ -0.04 | -0.0355220521159982 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,333,752 | 0.42 | 0.6 | ○○○○○ 0.39 | 0.392960665280912 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,333,456 | 0.45 | 0.78 | ○○○○○ 0.41 | 0.408475559249205 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,333,752 | 1.8 | 0.41 | ○○○○○ 1.11 | 1.11351694893208 | 23637626 |
Retrieved 15 of 15 entries in 1.1 ms
(Link to these results)