Bacterial taxon 909946
Locus STM474_3294
Protein WP_000544945.1
hydrogenase maturation nickel metallochaperone HypA
Salmonella enterica Serovar Typhimurium ST4 74
Length 113 aa, Gene hybF, UniProt E8XAJ4
>WP_000544945.1|Salmonella enterica Serovar Typhimurium ST4 74|hydrogenase maturation nickel metallochaperone HypA
MHELSLCQSAVEIIQQQAEQHGVARVTGVWLEIGALSCVEERAVRFSFDIACQGTLAQGCELHIDYRPAQAWCWDCSQVVEILRHDAQCPHCHGDRLRVDTGDSLKVKSIEVE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,328,315 | -2.78 | 0.011 | ●●○○○ -1.27 | -1.26749070161621 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,328,315 | 1.61 | 0.036 | ○○○○○ 1.01 | 1.01079192738848 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,328,315 | 1.89 | 0.42 | ○○○○○ 1.16 | 1.16081312286272 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)