Bacterial taxon 909946
Locus STM474_3629
Protein WP_001214118.1
hydrolase
Salmonella enterica Serovar Typhimurium ST4 74
Length 355 aa, Gene n/a, UniProt E8XE07
>WP_001214118.1|Salmonella enterica Serovar Typhimurium ST4 74|hydrolase
MRGIVLFPIINCSGAMVEITSTEMTPPVNNSHEFIPMRGIRNRHLQTMLPRLIRRKVKFNAHWQRLELPDGDFVDLAWSEDPQQAKYKPRLVVFHGLEGSLNSPYAHGLIEAAQKRGWLGVVMHFRGCSGEPNRLNRIYHSGETEDGAWFLRWLQREFGAVPTAAVGYSLGGNMLACLLAKEGRDIPIEAAVIVSAPFVLEACSYHMDKGFSRVYQRYLLNLLKANASRKLAAYPGSLPVNLAQLKSMRRIREFDDLITAKIHGFADAIDYYRQCSAMPLLNQIAKPTLIIHAKDDPFMDHHVIPKAEDLPPQVEYQLTEHGGHVGFIGGTPLRPEMWLERRIPDWLTTYLEASS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,634,162 | 1.93 | 0.012 | ○○○○○ 1.18 | 1.18140171803379 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,634,320 | 2.01 | 0.0098 | ○○○○○ 1.22 | 1.22141849183897 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,634,320 | 0.38 | 0.94 | ○○○○○ 0.38 | 0.376176471615762 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,634,320 | 0.53 | 0.71 | ○○○○○ 0.45 | 0.450593675164292 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,634,853 | 0.65 | 0.86 | ○○○○○ 0.52 | 0.515409398638802 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,634,162 | 0.69 | 0.85 | ○○○○○ 0.54 | 0.536504749425036 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,634,448 | 0.72 | 0.84 | ○○○○○ 0.55 | 0.551549963733454 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,634,853 | 0.83 | 0.34 | ○○○○○ 0.61 | 0.609786447444531 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 3,634,943 | 0.96 | 0.75 | ○○○○○ 0.67 | 0.673108437420654 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,634,853 | 1.18 | 0.48 | ○○○○○ 0.79 | 0.79043478693643 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,634,448 | 1.4 | 0.058 | ○○○○○ 0.91 | 0.906456674994124 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 3,634,943 | 1.62 | 0.08 | ○○○○○ 1.02 | 1.01850996046245 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,634,943 | 1.7 | 0.48 | ○○○○○ 1.06 | 1.05760748489119 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,634,448 | 1.86 | 0.43 | ○○○○○ 1.15 | 1.14521641813032 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 3,634,162 | 2.26 | 0.32 | ○○○○○ 1.35 | 1.3528561138346 | 23637626 |
Retrieved 15 of 15 entries in 1.1 ms
(Link to these results)