Bacterial taxon 909946
Locus STM474_0288
Protein WP_001541860.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 51 aa, Gene n/a, UniProt E8XIU1
>WP_001541860.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLCLAGFIVLILKEFTVNKWRNPTGWLCAVAMPFALLLLSGCGSSDSLLDP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 317,520 | -6.83 | 1.4e-6 | ●●●●○ -3.37 | -3.36890759128355 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 317,380 | -5.52 | 1.1e-5 | ●●●○○ -2.69 | -2.6899407097479 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 317,520 | -2.12 | 2.3e-5 | ●○○○○ -0.92 | -0.921736109477511 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 317,380 | -2.05 | 0.28 | ●○○○○ -0.89 | -0.88509761556003 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 317,520 | -0.49 | 0.92 | ●○○○○ -0.08 | -0.0756308313526058 | 23637626 |
Retrieved 5 of 5 entries in 1.1 ms
(Link to these results)