Bacterial taxon 909946
Locus STM474_0349
Protein WP_001675688.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 90 aa, Gene n/a, UniProt E8XJN3
>WP_001675688.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MTLKPGEKSGNNGGIYVEVGPRGGIKDNFATIAETKPRHQRNALKATGCWQKEHLTVNVSQSIWRHDSWRRLITVRPVLYRLASIVQDAP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 377,193 | -1.52 | 0.2 | ●○○○○ -0.61 | -0.612681820094559 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 377,193 | -0.62 | 0.81 | ●○○○○ -0.14 | -0.144353330921521 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 377,193 | 0.34 | 0.59 | ○○○○○ 0.35 | 0.351755195136253 | 23637626 |
Retrieved 3 of 3 entries in 1.4 ms
(Link to these results)