Bacterial taxon 909946
Locus STM474_0359
Protein WP_000545421.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 162 aa, Gene n/a, UniProt E8XJP3
>WP_000545421.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MHFHKRTLLSVATLGMLAVSVVLMVVWVRNSNHSSINTNEFLCTTRTVTTIQPKDIHADGSLVLDFKMKRITLQYEIKTKDNGVKILYRDVYMKNLHRTAPGVYTFEVSQVKVFATDTAGELLSHLRVLHPEAANEIRISKVGEKTFFYSLNRQLYNVCTAQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 389,336 | -6.19 | 5.6e-6 | ●●●●○ -3.04 | -3.03685241713986 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 389,336 | -3.8 | 5.6e-13 | ●●○○○ -1.8 | -1.79880033685635 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 389,078 | -3.74 | 4.3e-9 | ●●○○○ -1.76 | -1.76476902978591 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 389,078 | -2.34 | 0.013 | ●●○○○ -1.04 | -1.04033871179496 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 389,336 | -2.27 | 0.06 | ●○○○○ -1 | -0.999363629395127 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 389,078 | 0.5 | 0.91 | ○○○○○ 0.43 | 0.434378442189703 | 23637626 |
Retrieved 6 of 6 entries in 0.5 ms
(Link to these results)