Bacterial taxon 909946
Locus STM474_0430
Protein WP_010989124.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 108 aa, Gene n/a, UniProt E8XKJ7
>WP_010989124.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MRRRVAPTSHYFRRCHQPKNRPVAIPTSVGAARSCQIVMLNSVSVILPPLLQWQRFAAILNLSGVKLAPVMLPVNTEQCAGVFSFQRQGHRGSSPRNIAPHRVAPAYR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 466,868 | 0.07 | 0.97 | ○○○○○ 0.21 | 0.213938254485194 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 466,868 | 0.55 | 0.91 | ○○○○○ 0.46 | 0.461558632140764 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 466,676 | 0.58 | 0.44 | ○○○○○ 0.48 | 0.476307095475983 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 466,676 | 0.67 | 0.86 | ○○○○○ 0.53 | 0.526224536953061 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 466,868 | 0.77 | 0.3 | ○○○○○ 0.58 | 0.579401009116761 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 466,676 | 1 | 0.5 | ○○○○○ 0.7 | 0.698737065582413 | 23637626 |
Retrieved 6 of 6 entries in 1.9 ms
(Link to these results)