Bacterial taxon 909946
Locus STM474_0486
Protein WP_000779803.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 189 aa, Gene ybay, UniProt E8X852
>WP_000779803.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKLVHIVSGLAVAISLAACADKSADIQTPAPNPNMSITANQSTIQQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLSQKAVRTEGKQAPFSFVLPFNPSDIQPNARILLSAAITVDNKLVFITDSVKPVINNGGTKADLTLVPVQQTAVPVQASGGATTTVPSTSPTQVNSSSAVPAPTQY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 523,347 | 0.71 | 0.84 | ○○○○○ 0.55 | 0.547640182884064 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 523,347 | 0.84 | 0.25 | ○○○○○ 0.62 | 0.615467739082809 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 523,347 | 1.44 | 0.44 | ○○○○○ 0.93 | 0.92518479816778 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)