Bacterial taxon 909946
Locus STM474_0589
Protein WP_001520101.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 60 aa, Gene ybdg, UniProt E8X940
>WP_001520101.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MTAEWHLCKSGRLRFRHNQQQTGKSASGVIHTLYFILRPVNVVILRGSLFLNRRQSVNNE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 626,401 | -2.81 | 4.9e-8 | ●●○○○ -1.28 | -1.28371778067893 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 626,401 | -2.64 | 4.9e-5 | ●●○○○ -1.19 | -1.19347014701745 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 626,401 | -1.06 | 0.57 | ●○○○○ -0.37 | -0.374970626353018 | 23637626 |
Retrieved 3 of 3 entries in 1.1 ms
(Link to these results)