Bacterial taxon 909946
Locus STM474_0797
Protein WP_012219013.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 63 aa, Gene gpmA, UniProt E8XB02
>WP_012219013.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MPDDASLSGLRAIALLKPPPLKDKIATLNSQEPYTAPLFSLWLCVSIAANTSRQYNENYYHYI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 836,531 | -0.02 | 1 | ○○○○○ 0.17 | 0.167632294287804 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 836,531 | 0.21 | 0.8 | ○○○○○ 0.28 | 0.28425433671349 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 836,531 | 0.66 | 0.71 | ○○○○○ 0.52 | 0.518729439457642 | 23637626 |
Retrieved 3 of 3 entries in 1.3 ms
(Link to these results)