Bacterial taxon 909946
Locus STM474_0925
Protein WP_071527454.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 62 aa, Gene ybjE, UniProt E8XCP6
>WP_071527454.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MIKSPENMNSRALFYCLNSVHDTTEFQTISKATPSAVHLSDICPRQRGGISRQADAFAVILR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 972,352 | -3.24 | 6.8e-15 | ●●○○○ -1.51 | -1.50694321474662 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 972,352 | -1.42 | 0.16 | ●○○○○ -0.56 | -0.560991479700339 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 972,352 | -0.72 | 0.76 | ●○○○○ -0.19 | -0.194795637556766 | 23637626 |
Retrieved 3 of 3 entries in 0.7 ms
(Link to these results)