Bacterial taxon 909946
Locus STM474_0929
Protein WP_071524039.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 64 aa, Gene ybjZ, UniProt E8XCQ0
>WP_071524039.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MRWQGSNLADVICRPDKMQQCRHQALALNKNASRSGWHFASWMYTMRQRSYATASASMGTMTLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 978,320 | 1.19 | 0.63 | ○○○○○ 0.8 | 0.795478216764721 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 978,320 | 1.29 | 0.72 | ○○○○○ 0.85 | 0.848690006484063 | 23637626 |
Retrieved 2 of 2 entries in 1.8 ms
(Link to these results)