Bacterial taxon 909946
Locus STM474_0988
Protein WP_000301921.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 77 aa, Gene n/a, UniProt E8XDF4
>WP_000301921.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MAVVVVILTLINVLIKESHNIYYVLFFIPLIMIVLCLLLLNGAKMPIVVQFSPFFNGLDAAKLRTVIVITLKRLFAI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,050,140 | -1.44 | 0.036 | ●○○○○ -0.57 | -0.570098014414609 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,050,140 | -1.17 | 0.51 | ●○○○○ -0.43 | -0.431595828639661 | 23637626 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)