Bacterial taxon 909946
Locus STM474_0995
Protein WP_000917564.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 52 aa, Gene n/a, UniProt E8XDG0
>WP_000917564.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLKQCGYCRKSIDEGKEVKNTLLYRNGSQLASKEKEYCSRQCAEYDQMAHES
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,061,232 | -6.29 | 9.7e-24 | ●●●●○ -3.09 | -3.08807433149994 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,061,232 | -3.99 | 0.0092 | ●●○○○ -1.9 | -1.89543013917245 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,061,232 | -2.05 | 0.11 | ●○○○○ -0.89 | -0.887367145532509 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)