Bacterial taxon 909946
Locus STM474_1014
Protein WP_010989004.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 105 aa, Gene n/a, UniProt E8XDH7
>WP_010989004.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MPVTLQELRTSPRRGFCFFWWYIPLVSNHRGGDMGFYYVFQYKPKGMSSGKHLNVSEEFSDRNEAKRAKSRHMINDPDCVFSGIVQADSPAAVLQEVQAESLNRL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,069,233 | -1.43 | 0.038 | ●○○○○ -0.56 | -0.563138704823914 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,069,233 | -0.54 | 0.85 | ●○○○○ -0.1 | -0.103225585053422 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,069,233 | 0.13 | 0.93 | ○○○○○ 0.24 | 0.243134456386176 | 23637626 |
Retrieved 3 of 3 entries in 0.8 ms
(Link to these results)