Bacterial taxon 909946
Locus STM474_1016
Protein WP_000798705.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 149 aa, Gene n/a, UniProt E8XDH9
>WP_000798705.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MKNTALGKFIFIVGTALLLGGCSGMVMPPYATHGTSVGIIAPAGGYSEWHTDSRNHTTGDSHSQSQGNCTQSEDSQLNENGLTRTHQSNCNTRSQTHSSSTSKTRSSSVGFSVGGPVGASIGLIKQMESMNRAPANDMSSNEMFKNFGF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,069,792 | -1.86 | 0.00065 | ●○○○○ -0.79 | -0.790547971986991 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,069,792 | -1.35 | 0.44 | ●○○○○ -0.52 | -0.522806768780679 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,069,792 | -0.36 | 0.9 | ●○○○○ -0.01 | -0.0099809752232905 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,069,872 | 0.42 | 0.94 | ○○○○○ 0.4 | 0.395959826725921 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,069,872 | 0.67 | 0.38 | ○○○○○ 0.52 | 0.522744247035807 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,069,872 | 1.61 | 0.37 | ○○○○○ 1.01 | 1.01137107495663 | 23637626 |
Retrieved 6 of 6 entries in 0.8 ms
(Link to these results)