Bacterial taxon 909946
Locus STM474_1089
Protein WP_001742094.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 60 aa, Gene hiuh, UniProt E8XE53
>WP_001742094.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MRAVRVQTGCANNAWWDRLLDCINRRDLWRANIAAGIKIFSVSTLLPQAVVIPLVGMSDG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,141,487 | -0.95 | 0.37 | ●○○○○ -0.31 | -0.313662383595312 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,141,487 | 0.59 | 0.29 | ○○○○○ 0.48 | 0.483423182546172 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,141,487 | 0.77 | 0.83 | ○○○○○ 0.57 | 0.57478391122915 | 23637626 |
Retrieved 3 of 3 entries in 1.2 ms
(Link to these results)