Bacterial taxon 909946
Locus STM474_1105
Protein WP_012218966.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 64 aa, Gene cbpA, UniProt E8XE69
>WP_012218966.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MRCAVQTITTTHARQRNHQPIRCCFAIAPSLFNASYLSHWRGFGNLSPVKLCRRAAQPSDSRTT
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,156,371 | 0.5 | 0.7 | ○○○○○ 0.44 | 0.437563559331199 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,156,371 | 0.56 | 0.44 | ○○○○○ 0.47 | 0.468600996773644 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,156,371 | 0.59 | 0.97 | ○○○○○ 0.49 | 0.485381873056348 | 23637626 |
Retrieved 3 of 3 entries in 0.4 ms
(Link to these results)