Bacterial taxon 909946
Locus STM474_1114
Protein WP_001273663.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 55 aa, Gene ymdF, UniProt E8XE78
>WP_001273663.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MANHRGGSGNFAEDRERASEAGRKGGQHSGGNFKNDPQRASEAGKKGGKSSNRNS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,162,611 | -0.2 | 0.73 | ○○○○○ 0.07 | 0.0712857656892255 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,162,611 | 0.2 | 0.88 | ○○○○○ 0.28 | 0.282341118439038 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,162,611 | 0.56 | 0.93 | ○○○○○ 0.47 | 0.469661726175798 | 23637626 |
Retrieved 3 of 3 entries in 1.6 ms
(Link to these results)