Bacterial taxon 909946
Locus STM474_1119
Protein WP_000245336.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 98 aa, Gene putP, UniProt E8XE83
>WP_000245336.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MVMSAPGHIVYSSYNTLYGHSLSGGGLVILKALIISLTDHTHDVICGARSRVWRRFKKQAKAYKEANPQMCVRIIAFKRTRVMYTYNSRCYPWEDKKQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,170,577 | -0.73 | 0.58 | ●○○○○ -0.2 | -0.201187888187414 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,170,577 | 0.18 | 0.99 | ○○○○○ 0.27 | 0.272350744341992 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,170,577 | 0.28 | 0.65 | ○○○○○ 0.32 | 0.320558968389079 | 23637626 |
Retrieved 3 of 3 entries in 1.5 ms
(Link to these results)