Bacterial taxon 909946
Locus STM474_1129
Protein WP_000950664.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 54 aa, Gene n/a, UniProt E8XE92
>WP_000950664.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MLSPEQYCAECDCACYQRFQRDVQHSKFPGAGKKSSFRLLKPQIGGSLYKRAFF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,181,201 | 0.46 | 1 | ○○○○○ 0.42 | 0.417046722549159 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,181,201 | 0.67 | 0.89 | ○○○○○ 0.52 | 0.522707919932345 | 23637626 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)