Bacterial taxon 909946
Locus STM474_1184
Protein WP_000528430.1
hypothetical protein
Salmonella enterica Serovar Typhimurium ST4 74
Length 74 aa, Gene n/a, UniProt E8XEV6
>WP_000528430.1|Salmonella enterica Serovar Typhimurium ST4 74|hypothetical protein
MGNSLTRTYTAVDTLWDKTHRTSVRNTNAFFLVGEWIDQETGPHEESEDRQALNCSQQALSSWLELEAVETAPQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,230,419 | -1.9 | 0.11 | ●○○○○ -0.81 | -0.807769282201662 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,230,419 | -0.97 | 0.069 | ●○○○○ -0.33 | -0.328872633525939 | 23637626 |
| Pig (Sus scrofa) | colonic mucosa | BTO:0000271 | 3 days | 1,230,545 | -0.13 | 0.93 | ○○○○○ 0.11 | 0.110369115422621 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,230,419 | 0.15 | 1 | ○○○○○ 0.26 | 0.256260993903095 | 23637626 |
| Chicken (Gallus gallus) | cecum | BTO:0000166 | 4 days | 1,230,545 | 0.69 | 0.86 | ○○○○○ 0.54 | 0.53682836506814 | 23637626 |
| Cow (Bos taurus) | ileal mucosa | BTO:0000619 | 4 days | 1,230,545 | 1.28 | 0.1 | ○○○○○ 0.84 | 0.842236791940207 | 23637626 |
Retrieved 6 of 6 entries in 1.5 ms
(Link to these results)